پایان نامه اثر درصد ماده خشک شیر و ترکیبی از گیاهان دارویی بر عملکرد و فراسنجه های خونی گوساله های شیر خوار

word 1 MB 32463 105
1392 کارشناسی ارشد مهندسی علوم دامی - دامپروری - دام و طیور
قیمت قبل:۳۷,۹۰۰ تومان
قیمت با تخفیف: ۳۳,۶۰۰ تومان
دانلود فایل
  • بخشی از محتوا
  • وضعیت فهرست و منابع
  • پایان نامه برای دریافت درجه کارشناسی ارشد

    در رشته مهندسی کشاورزی علوم دامی – تغذیه دام

     

    چکیده

              برای مطالعه اثر درصد ماده خشک شیر و ترکیبی از گیاهان دارویی بر عملکرد آزمایشی در قالب طرح پایه کاملا تصادفی با آرایش فاکتوریل 2×2 بر روی 40 راس گوساله نر هلشتاین از سن 10 روزگی تا 70 روزگی طراحی شد. که هر تیمار شامل 10 تکرار بود تیمار آزمایشی عبارت بودند از: تیمار1) 7 کیلوگرم شیر حاوی 5/12 درصد ماده خشک (CO)، تیمار2) 7 کیلوگرم شیر حاوی 5/12 درصد ماده خشک همراه با افزودنی گیاهی (PCO)، تیمار 3) 7 کیلوگرم شیر حاوی 20 درصد ماده خشک (HD)، تیمار 4) 7 کیلوگرم شیر حاوی 20 درصد ماده خشک همراه با افزودنی گیاهی (PHD) بودند. افزودنی گیاهان دارویی ترکیبی از گیاه خشک شده رزماری، زنجبیل و مرزه بود که روزانه 10 گرم از این مخلوط آسیاب شده به شیر وعده صبح اضافه شد. برای بالا بردن ماده خشک شیر در هر وعده 5/262 گرم شیر کامل خشک شده را به 5/3 لیتر شیر اضافه و مخلوط کردیم. داده­های بدست آمده در مورد ماده خشک مصرفی، وزن بدن، امتیاز مدفوع، رشد اسکلتی، فراسنجه­های خونی توسط نرم افزار SAS مورد تجزیه و آنالیز قرار گرفتند. در پیش از شیرگیری آنالیز داده­ها نشان داد که میانگین ماده خشک مصرفی روزانه و کل دوره ، افزایش وزن روزانه و کل دوره  تا 40 روزگی در گوساله­های تغذیه شده با شیر حاوی20 درصد ماده خشک نسبت به گروه تغذیه شده با شیر حاوی5/12 درصد ماده خشک به طور معنی­داری بالاتر بود (0001/0=P)، اما پس از شیرگیری تفاوت معنی­داری بین عملکرد تیمارها مشاهده نشد، عرض بین استخوان هیپ به طور معنی­داری در گروهی که شیر با ماده خشک بالاتر خورده بودند بالاتر بود (0001/0=p). افزودن مخلوط گیاهان دارویی اثر معنی­داری بر روی عملکرد گوساله­ها نداشت(05/0

     

              کلمات کلیدی: شیر، ماده خشک شیر، گیاهان دارویی، افزایش وزن

     

    فصل اول

    « مقدمه و طرح پژوهش »

     

    مقدمه

           گوساله‌ها از زمان تولد تا شیرگیری بدلیل تغییرات شگرف فیزیولوژیکی و متابولیکی که به موجب آن ها از یک موجود تک‌معده‌ای به یک نشخوارکننده تبدیل می‌شوند، تحت تاثیر تنش قابل توجهی قرار می‌گیرند. به منظور تولید مطلوب گاوهای پر‌‌تولید، باید گوساله‌های شیرخوار با استعداد ژنتیکی بالا را به روش مناسب و بهینه تغذیه کرد، اقتصادی بودن گاوداری تا اندازه زیادی تابع موفقیت گاودار در رشد و پرورش گوساله‌ها جهت جایگزینی است. امروزه دیدگاه­های متفاوتی در رابطه با روش­ها و مقادیر تغذیه شیر به گوساله­­ها ارائه شده است، خان(2011) گزارش کرد که تغذیه مقادیر بالای شیر به گوساله­ها سبب افزایش وزن روزانه، بهبود بازده خوراک ودر نهایت بهبود عملکرد گوساله شده است[89]. در همین خصوص دیده شده است که تغذیه مقدار بالای شیر در سنین اولیه می­تواند اثرات طولانی مدتی بر عملکرد گوساله داشته باشد، سوبرون(2009) گزارش کرد هنگامی که به گوساله­ها شیر بیش تری خورانده شد این حیوانات در دوره شیر­دهی شیر بیش تری تولید کردند[141]. میلریا(1966)، افزایش امتیاز مدفوع و افزایش روزهای ابتلا به اسهال در هنگام ارائه مقادیر بالای شیر را مشاهده کرد[102]. اطلاعات محدودی در رابطه با افزایش ماده خشک شیر وجود دارد و این در حالیست که شاید افزایش در ماده خشک شیر راهکار موثری نسبت به خوراندن مقادیر بالاتر شیر بدون ایجاد مشکلات سلامتی برای گوساله­های جوان باشد. در صنعت دامپروری و به ویژه گاوداری یکی از اهداف اصلی تولید تعداد گوساله بیش تر، سالم­­ترو در نهایت افزایش سود است. هدف اصلی درکلیه فعالیت­های صنعتی افزایش تولید در قسمت­های مختلف ودرنهایت افزایش­سودآوری واحد صنعتی است. در مزارع مدرن پرورش گاو ­های شیری افزایش مرگ و میرگوساله­ها یکی از اصلی­ترین عوامل­ عدم سودآور بودن واحد دامپروری است که  از جمله اصلی­ترین دلیل این مرگ و میر اسهال و ضعف در سیستم ایمنی بدن در روزهای اولیه پس از تولد گزارش شده است افت در سیستم ایمنی به هر دلیلی می­تواند افزون بر افزایش هزینه پرورش گوساله که شامل هزینه­های درمانی و کارگری بیش تر است افت در عملکرد شامل کاهش مصرف خوراک، کاهش افزایش وزن روزانه و افت در بازده استفاده از خوراک را به همراه داشته باشد که همسویی این مسائل می­تواند ضرر اقتصادی را به همراه داشته باشد. بنابراین روشن است که افزایش کارایی سیستم ایمنی می­تواند تا حد بالایی به سلامت گوساله­ها کمک و بهبود عملکرد و در نهایت سود اقتصادی بیش تر را تضمین کند . استفاده از آنتی‌بیوتیک به عنوان محرک رشد، باعث افزایش سرعت رشد و افزایش میزان تولیدات و در نتیجه سود حاصل از پرورش می‌گردد. با توجه به تاثیر استفاده از آنتی بیوتیک‌ها در بهبود سلامت، حیوان می‌تواند از مواد مغذی در جهت رشد و تمایز بهتر به جای استفاده از مواد مغذی در مسیر مبارزه با عفونت‌ها استفاده نماید. پژوهش­گران گزارش کردند که استفاده مداوم و نا منظم از مقادیر زیاد آنتی بیوتیک ها در خوراک حیوانات، سبب ایجاد باکتری‌های مقاوم می‌شود[73]. چاوز و همکاران (2008) گزارش کردند احتمال انتقال باقیمانده آنتی­‌بیوتیک­ها از طریق مصرف فرآورده­های­ دامی، به انسان نیز وجود دارد[33]. بنابراین باید جایگزین‌هایی را به جای استفاده از آنتی‌بیوتیک‌های محرک رشد شناسایی و به پرورش‌دهندگان دام معرفی کرد که نه تنها بازده و سود اقتصادی دچار کاهش نشود و بلکه نگرانی‌ها در مورد سلامت مصرف کنندگان بر طرف گردد[64]. در سال‌های اخیر ترکیباتی تحت عنوان پروبیوتیک، پری بیوتیک‌ها، اسیدهای آلی و روغن‌های ضروری به عنوان جایگزین آنتی‌بیوتیک‌های محرک رشد مورد بررسی قرار گرفتند[45]. از آنجایی که عملکرد مناسب گوساله در روزهای اول پس از تولد و شیرخوارگی ضامن بقاء و حفظ شرایط بهینه یک گله در آینده خواهد بود و با توجه به اهمیت این موضوع و وجود گاهی نتایج متناقض در پژوهش­های انجام گرفته در این زمینه و هم­چنین عدم مطالعه این موضوع در شرایط محیطی و سیستم‌های پرورش گاو شیری در ایران، لازم و ضروری است که در طی یک سری آزمایش تاثیر شیر، شیر با ماده خشک بالا و مخلوطی از گیاهان دارویی بر عملکرد گوساله­های شیر خوار مورد بررسی قرار گیرد.

     

     

    1-1- اهداف طرح

    بررسی اثرات ، شیر با ماده خشک بالا بر عملکرد ومتابولیت­های خونی گوساله­های شیرخوار      بررسی اثرات مخلوطی از گیاهان دارویی بر عملکرد و متابولیت­های خونی گوساله­های شیرخوار

     بررسی اثر متقابل شیر با ماده خشک بالا و مخلوطی از گیاهان دارویی بر عملکرد و متابولیت­های خونی گوساله­های شیرخوار

     

    1-2- فرضیه­های پژوهش

    استفاده از شیر با ماده خشک بالا منجر به عملکرد گوساله­ها می­شود.

    استفاده از گیاهان دارویی در شیر منجر به بهبود عملکرد گوساله­ها می­شود.

    افزودن گیاهان دارویی به شیر منجر به ایجاد یک پروفایل متابولیکی مطلوب­تر در گوساله­های شیرخوار می­شود.

    ABSTRACT

    In order to investigate  the effect of the milk with  high  dry matter on dairy  calves performance, in a 2*2 experiment factorial ,forty calves(10 per treatment) were randomly to 4 treatments and were studied  for 40 days.The treatments were included 1)7kg  milk with 12.5 %DM without   herbal additive  (CO) 2) 7 kg milk with 12.5 %DM with   herbal  additive  (PCO), 3)  7 kg milk with20 % DM without   herbal  additive  (HD) and 4) 7 kg milk with20 % DM with   herbal additive  (PHD).

    Additive medicinal plants were a mixture of 10 grams of dried and milled rosemary, ginger and fennel that added to milk morning. To enhance dry milk per meal was added 262.5 gr  of dried whole milk to 3.5 l of milk. The average of  daily and  total dry matter intake, avearage daily gain and starter intake in calves fed with 20 % DM milk was Significantly higher than calves were fed with 12.5 % DM milk (p<0.05), but there wasn,t  significant between experimental treatments in post weaning. The hip bone width was significantly higher in calves fed with 20 % DM milk than calves were fed with 12.5 % DM milk (p=0.0001). The plant mixture has  no effect on the parameter  measurements.  But the mixture of medicinal plants, the Dry matter level of milk  and the their interaction  was improved blood indices in calves, as increased serum glucose and  albumin concentrations and decreased serum total protein and globulin concentrations. In general, feeding milk with higher dry milk improved growth and health performance in calves.

    Key words: Milk, milk dry matter content, herbal mixture, Body weight gain

  • فهرست:

     

    چکیده......................................................................................................................................................................1

    فصل اول: مقدمه

    مقدمه.......................................................................................................................................................................4

    1-2- اهداف طرح.................................................................................................................................................6

    1-3- فرضیه­های طرح.........................................................................................................................................6

    فصل دوم: بررسی منابع

    2- 1- مقدار مواد مغذی  مورد نیاز گوساله­های جوان.................................................................................8

    2-2- انرژی مورد نیاز گوساله­ها.........................................................................................................................9

    2-2-1- متابولیسم در حالت ناشتا (میزان متابولیسم پایه)........................................................................9

    2-2-2- انرژی قابل متابولیسم.......................................................................................................................10

    2-3- پروتئین مورد نیاز گوساله­ها.................................................................................................................12

    2-3-1- پروتئین مورد نیاز برای نگهداری ..................................................................................................12

    2-3- 2- اثرات شرایط محیطی بر روی انرژی و پروتئین مورد نیاز گوساله.... ....................................16

    2-4- سایر جنبه­های تغذیه گوساله .............................................................................................................17

    2-4- 1- تغذیه جنین .....................................................................................................................................17

    2-4- 2- آغوز.....................................................................................................................................................18

    2-4- 3- آب و الکترولیت­ها ...........................................................................................................................19

    2-4- 4- مواد جایگزین شیر ..........................................................................................................................20

    2-4- 5- مواد افزودنی ....................................................................................................................................22

    2-4- 6- توجهات عملی خوراک دادن ........................................................................................................23

    2-5- شیر و عملکرد گوساله............................................................................................................................25

    2-5-1- شیر و ماده خشک موجود درآن.....................................................................................................25

    2-5-2- شیر و خوراک مصرفی......................................................................................................................26

    2-5-3- دوره پیش از شیرگیری....................................................................................................................31

    2-5-4- دوره پس از شیرگیری......................................................................................................................33

    2-5-5- اثرات طولانی مدت............................................................................................................................34

    256 توسعه شکمبه.....................................................................................................................................35

    2-6- معرفی گیاهان دارویی و تاثیر آن بر عملکرد حیوانات....................................................................37

    2-6-1- تاثیر رزماری بر عملکرد حیوانات....................................................................................................40

    2-6-2- تاثیر مرزه بر عملکرد حیوانات.........................................................................................................41

    2-6-3- تاثیر زنجبیل بر عملکرد حیوانات...................................................................................................42

    2-6-4- اشکال متداول استفاده از گیاهان دارویی در دامپروری.............................................................44

    2-6-4-1- پودر.................................................................................................................................................44

    2-6-4-2- چای­ها.............................................................................................................................................45

    2-6-4-3- جوشانده­ها......................................................................................................................................45

    2-6-4-4- خیسانده گیاه.................................................................................................................................45

    2-6-4-5- عصاره­ها...........................................................................................................................................46

    2-6-4-6- اسانس­ها..........................................................................................................................................47

    2-6-4-7- کپسولها و قرص­ها......................................................................................................................47

    2-6-4-8- ضمادها............................................................................................................................................47

    2-6-4-9- کمپرس­ها.......................................................................................................................................47

    2-6-4-10- شربت............................................................................................................................................48

    2-6=4- 11- لوسیون.......................................................................................................................................48

    2-6-4- 12- پماد و کرم­ها.............................................................................................................................48

    2-6-4-13- اسپری، بخور...............................................................................................................................48

    2-6-4-14- دود­ دادن.....................................................................................................................................48

    فصل سوم: مواد و روش کار

    3-1- مکان و زمان اجرای طرح......................................................................................................................50

    3-2- نحوه اجرای طرح ...................................................................................................................................50

    3-3- مدیریت گوساله‌‌ها ..................................................................................................................................51

    3-4- اندازه گیری ها و نمونه برداری ها.......................................................................................................52

    3-4-1- خوراک مصرفی..................................................................................................................................52

    3-4-2- وزن بدن..............................................................................................................................................53

    3-4-3- امتیاز مدفوع.......................................................................................................................................53

    3-4-4- رشد اسکلتی.......................................................................................................................................53

    3-4-5- نمونه‌گیری از خون. 53

    3-5- تجزیه و تحلیل آماری. 54

    فصل چهارم: بحث و نتایج

    4- مصرف جیره آغازین, ماده خشک مصرفی، افزایش وزن روزانه, بازده خوراک ,وزن از شیرگیری و وزن نهایی............................................................................................................................................................58

    41- جیره آغازین مصرفی...............................................................................................................................58

    42- ماده خشک مصرفی.................................................................................................................................61

    43- بازده خوراک.............................................................................................................................................63

    44- افزایش وزن روزانه...................................................................................................................................67

    4-5- وزن از شیرگیری و وزن نهایی..............................................................................................................69

    46- امتیاز مدفوع..............................................................................................................................................70

    47- صفات مربوط به رشد اسکلتی..............................................................................................................71

    4-7-1- دور سینه..............................................................................................................................................71

    4-7-2- عرض بین استخوان هیپ.................................................................................................................72

    48- فراسنجه‌های سرم خون در دوره‌های 9، 30، 40 و 70 روزگی....................................................72

    48-1- بتا- هیدروکسی بوتیرات...................................................................................................................76

    48-2- گلوکز.....................................................................................................................................................76

    48-3- آلبومین.................................................................................................................................................79

    48-4- پروتئین کل.........................................................................................................................................81

    48-5- گلوبولین...............................................................................................................................................82

    فصل پنجم:  نتیجه گیری

    5 نتیجه گیری...................................................................................................................................................85

    51 مشکلات و محدودیت‌های این پژوهش...............................................................................................85

    52 پیشنهادات.................................................................................................................................................85

    منابع.................

    منبع:

    man, M. M. and R.L.Kincaid. 1995. Effect of selenium supple mentation of cows on maternal transfer of selenium to fetal and new born calves. J.DairySci 78:625– 630.

    [2]       Abdollahiacdefg, M., A. Salehniaag, S. H. R. Mortazavib, M. Ebrahimi, A. Shafiee, F. Fouladian, K. Keshavarz, S. Sorouri, R. Khorasani, and A. Kazemi. 2003. Antioxidant, antidiabetic, antihyperlipidemic, reproduction stimulatory properties and safety of essential oil of Satureja Khuzestanica in rat in vivo:a toxicopharmacological study. Med Sci Monit 9:331-335.

    [3]       Abe, F., N.Ishibashi and Shimamura. 1995. Effect of administration of bifidobacteriaand lactic acid bacteria to new born calves and piglets J. DairySci 78:2838– 2846.

    [4]       Amagase, H., B. L. Petesch, H. Matsuura, S. Kasuga, and Y. Itakura. 2001. Intake of garlic and its bioactive components. Journal of Nutrition 131 955S-962S.

    [5]       Anderson, K. L., T.G.Nagaraja, and J.L.Morrill. 1987a. Ruminal metabolic develop mentin calves weaned conventionallyorearly. J. DairySci 70:1000– 1005.

    [6]       Anderson, K. L., T.G.Nagaraja, J.L.Morrill, T.B.Avery, S.J.Galitzer, and J.E.Boyer. 1987b. Ruminalmicrobialdevelopmentinconventionally orearly weaned calves. J.Anim.Sci 64:1215- 1226.

    [7]       Appleby, M. C., D. M. Weary, and B. Chua. 2001. Performance and feeding behavior of calves on ad libitum milk from artificial teats. Appl. Anim. Behav. Sci. 74:191–201.

    [8]       Arash Khaki, D., F. Fathiazad, M. Nouri, A. Afshin, and D. Hamadeh. 2009. The effects of Ginger on spermatogenesis and sperm parameters of rat. Iranian Journal of Reproductive Medicine 7(1):7-12.

    [9]       Arieli, A., J. W. Schrama, and W. Van Der Hel. 1995. Develo energy in young calves. J. Dairy Sci 78:1154–1162.

    [10]     Arthington, J. D., M.B.Cattell, and I. J.D.Quigley. 2000. Effectof dietary IgG source (colostrum,serum,ormilk-derivedsupplement) on the efficiency of Ig absorptionin new born Holstein calves. J.Dairy Sci 83:1463– 1467.

    [11]     BakIrel, T., U. BakIrel, O. Ü. Keles, S. G. Ülgen, and H. Yardibi. 2008. In vivo assessment of antidiabetic and antioxidant activities of rosemary (Rosmarinus officinalis) in alloxan-diabetic rabbits. Journal of Ethnopharmacology 116(1):64-73.

    [12]     Baldwin, R. L. V., K. R. McLeod, J. L. Klotz, and R. N. Heitmann. 2004. Rumen development, intestinal growth and hepatic metabolism

    in the pre- and postweaning ruminant. J. Dairy Sci 87:(E.Suppl.):E55–E65.

    [13]     Ballou, M. A., C. J. Cobb, T. J. Earleywine, and B. S. Obeidat. 2013. Interaction of breed and plane of milk replacer nutrition on the performance of pre- and postweaned dairy calves. Prof. Prof. Anim. Sci 29:116–123.

    [14]     Bampidis, V. A., V. Christodoulou, P. Florou-Paneri, E. Christaki, A. B. Spais, and P. S. Chatzopoulou. 2005. Effect of dietary dried oregano leaves supplementation on performance and carcass characteristics of growing lambs. Animal Feed Science and Technology 121:285–295.

    [15]     Bañón, S., L. Méndez, and E. Almela. 2011. Effects of dietary rosemary extract on lamb spoilage under retail display conditions. Meat Science.

    [16]     Banziger, M., G. O. Edmeades, and H. R. Lafitte. 2002. Physiological mechanisms contributing to the increased N stress tolerance of tropical maize  selected for drought tolerance. Field crops res. 75:223-233.

    [17]     Bartlett, K. S., F. K. McKeith, and M. J. VandeHaar. 2006. Growth and body composition of dairy calves fed milk replacers containing different amounts of protein at two feeding rates. J. Anim. Sci 84: 1454–1467.

    [18]     Beharka, A. A., T.G.Nagaraja, and J.L.Morrill. 1991. Performanceand ruminal functiondevelopmentofyoungcalvesfeddietswithAspergillus oryzae fermentationextract. J.DairySci 74:4326– 4336.

    [19]     Beharka, A. A., T.G.Nagaraja, J.L.Morrill, G.A.Kennedy, and R.D.Klemm. 1998. Effects off or mofthedieton anatomical,microbial,and fermentative development of therumen of neonatal calves. J.Dairy Sci 81:1946– 1955.

    [20]     Besser, T. E., C.C.Gay, and L.Pritchett. 1991. Comparisonofthree methods offeeding colostrum to dairy calves. J.Am.Vet.Med.Assoc 198:419– 422.

    [21]     Blaxter, K. L. and W. A. Wood. 1951. The nutrition of yaoung Ayrish calf. 1. The endogenouse nitrogen and energy metabolism of calf. Br. j. Nutr 5(1):1-12.

    [22]     Blome, R. M., J. K. Drackley, McKeith, and F. K. 2003. Growth, nutrient utilization, and body composition of dairy calves fed milk replacers containing different amounts of protein. J. Anim. Sci 81:1641-1655.

    [23]     Blum, J. W. 2006. Nutritional physiology of neonatal calves. J. Anim.Physiol. Anim. Nutr: (Berl.) 90:91–11.

    [24]     Blum, J. W. and C. R. Baumrucker. 2002. Colostral and milk insulinlike growth factors and related substances: Mammary gland and neonatal (intestinal and systemic) targets. Domest. Anim. Endocrinol 23:101–110.

    [25]     BOMBIK, T., E. BOMBIK, A. FRANKOWSKA, B. TRAWIŃSKA, and L. SABA. 2012. EFFECT OF HERBAL EXTRACTS ON SOME HAEMATOLOGICAL

    PARAMETERS OF CALVES DURING REARING. Bull Vet Inst Pulawy 56:655-658.

    [26]     Booth, A. J. and J.M.Naylor. 1987. Correction ofmetabolic acidosisin diarrheal calves byoral administration of electrolytesolution swithor without bicarbonate. J.Am.Vet.Med.Assoc 191:62– 68.

    [27]     Brown, E. G., M. J. Vandehaar, K. M. Daniels, J. S. Liesman, L. T. Chapin, J. W. Forrest, R. M. Akers, R. E. Pearson, and M. S. W. Nielsen. 2005. Effect of increasing energy and protein intake on mammary development in heifer calves. J. Dairy Sci 88:595–603.

    [28]     Brown, E. G., M. J. Vandehaar, K. M. Daniels, J. S. Liesman, L. T. Chapin, J. W. Forrest, R. M. Akers, R. E. Pearson, and M. S. W. Nielsen. 2005. Effect of increasing energy and protein intake on mammary development in heifer calves. J. Dairy Sci. 88:595–603.

    [29]     Brownlee, A. 1956. Thedevelopmentofrumenpapillaeincattlefedon different diets. Br.Vet.J 112:369– 375.

    [30]     C.L, D. and J.H.Clark. 1981. Ruminant digestion and metabolism. Dev. Ind.Microbiol 22:247– 259.

    [31]     Calsamigilia, S., M. Busquet, P. W. Cardozo, L. Castillejos, and A. Ferret. 2007. Invited review: Essential oil as modifiers of rumen microbial fermentation. J. Dairy Sci. 90: 2580-2595.

    [32]     Chao, S. C., D. G. Young, and C. J. Oberg. 2000. Screening for inhibitory

    activity of essential oils on selected bacteria, fungi and viruses. Journal of

    Essential Oil Research 12: 639–649.

    [33]     Chaves, A. V., K. Sanford, L. L. Gibson, T. A. McAllister, and C. Benchaar. 2008. Effect of carvacrol and cinnamaldehyde on intake, rumen fermentation, growth performance and carcass characteristics of growing lambs. Anim. Feed. Sci.Tech 145:396-408.

    [34]     Council, N. R. 2001. Nutrient requirements of dairy cattle. 7th edition. Washington. DC: National Academy Press.

    [35]     Curnick, K. E., L.D.Muller, J.A.Rogers, T.J.Snyder, and T.F.Sweeney. 1983. Addition of sodium bicarbonate tocalf starter rations varying inprotein percent. J.DairySci 66:2149– 2160

     

    [36]     Davis, C. L. and J.K.Drackley. 1998. The Development,Nutrition,and Management of theYoung Calf. Iowa State University Press,Ames,Iowa.

    [37]     Davis Rincker, L. E., M. J. VandeHaar, C. A. Wolf, J. S. Liesman, L. T. Chapin, and M. S. W. Nielsen. 2011. Effect of intensified feeding of heifer calves on growth, pubertal age, calving age, milk yield, and economics. J. Dairy Sci 94:3554–3567.

    [38]     de Passillé, A. M. B. 2001. Sucking motivation and related problems in calves. Appl. Appl. Anim. Behav. Sci 72:175–187

     

    [39]     de Passillé, A. M. B. and J. Rushen. 2006. Calves’ behaviour during nursing is affected by feeding motivation and milk availability. Appl. Anim. Behav. Sci. 101:264–275.

    [40]     De Paula Vieira, A., M. A. G. v. Keyserlingk, and D. M. Weary. 2010. Effects of pair versus single housing on performance and behavior of dairy calves before and after weaning from milk. J. Dairy Sci 93:3079–3085.

    [41]     Diaz, M. C., M. E. V. Amburgh, and J. M. Smith. 2001. Composition of growth of Holstein calves fed milk replacer from birth to 105-kilogram body weight. J. Dairy Sci 84: 830–842.

    [42]     Diaz, M. C., M. E. V. Amburgh, J. M. Smith, J. M. Kelsey, and E. L. Hutten. 2001. Composition of growth of Holstein calves fed milk replacer from birth to 105-kilogram body weight. J. Dairy Sci. 84:830–842.

    [43]     Donnelly, P. E. and J. B. Hutton. 1976a. Effect of dietarry protein and energy on growth of Friesian bull calves. I. food intake, growth, and protein requirements. N. Z. J. Agri. Res 19:289-297.

    [44]     Donnelly, P. E. and J. B. Hutton. 1976b. Effects of dietary protein and energy on growth of Friesian bull calves. II. Effects of level of feed intake and dietary protein content on body composition. N. Z. J. Agri. Res 19: 409–414.

    [45]     Donovan, D. C., S. T. Franklin, C. C. L. Chase, and A. R. Hippen. 2002. Growth and health of Holstein calves fed milk replacers supplemented with antibiotics or enteroguard. J. Dairy. Sci. 85:947-950.

    [46]     Drackley, J. K. 2008. Calf nutrition from birth to breeding. Vet. Clin. North Am. Food Anim. Pract. 24:55–86.

    [47]     Drackley, J. K. 2008. Calf nutrition from birth to breeding. Vet. Clin North Am. Food Anim . Pract 24:55–86.

    [48]     Eicher-Pruiett, S. D., J.L.Morrill, T.G.Nagaraja, J.J.Higgins, N.V.Anderson, and P.G.Reddy. 1992. Response of young dairy calves with lasalocid delivery varied in feed sources. J.DairySci 75:857– 862.

    [49]     Foley, J. A. and D.E.Otterby. 1978. Availability, storage, treatment,composition, and feeding value of surplus colostrum:areview. .J.Dairy Sci 61:1033– 1060.

    [50]     Forbes, J. M. 1971. Physiological changes affecting voluntary food intake

    in ruminants. Proc. Nutr. Soc. 30:135–142.

    [51]     Galambosi, B. 1994. Herb production in Finland during 1981-1993. Proc. NJF Seminar No. 240. Scandinavian Assoc. of Agri. Sci. Helsinki, Finland,pp. 22-25.

    [52]     Galyean, M. L., L. J. Perino, and G. C. Duff. 1999. Interaction of cattle health/immunity and nutrition. J. Anim. Sci. 77:1120–1134.

    [53]     Garry, F. B., M. B. R.Adams, Cattell, and R.P.Dinsmore. 1996. Comparison of passive immunoglobulin transfer to dairy calves fed colostrum or commercially available colostral supplement products. J.Am.Vet.Med 1:107– 110.

    [54]     Gerrits, W. J. J., E. Decuypere, M. W. A. Verstegen, and V. Karabinas. 1998. Effect of protein-free energy intake on plasma concentrations of insulin-like growth factor I and thyroid hormones in preruminant veal calves. J. Anim. Sci 76:1356–1363.

    [55]     Ghalamkari, G., M. Toghyani, E. Tavalaeian, N. Landy, Zahra, Ghalamkari, and H. Radnezhad. 2011. Efficiency of different levels of Satureja hortensis L. (Savory) in comparison with an antibiotic growth promoter on performance, carcass traits, immune responses and serum biochemical parameters in broiler chickens. African Journal of Biotechnology 10:13318-13323.

    [56]     Giordani, R., P. Regli, J. Kaloustian, C. Mika¨ıl, L. Abou, and H. Portugal. 2004. Antifungal effect of variousessential oils against Candida albicans.Potentiation of antifungal action of Amphotericin B by essential oil from

    Thymus vulgaris. Phytotherapy Research 18: 990–995.

    [57]     Godden, S. M., J. P. Fetrow, J. M. Feirtag, L. R. Green, and S. J. Wells. 2005. Economic analysis of feeding pasteurized nonsaleable milk versus conventional milk replacer to dairy calves. J. Am. Vet. Med. Assoc

     226:1547–1554

     

    [58]     Greenwood, R. H., J.L.Morrill, E.C.Titgemeyer, and G.A.Kennedy. 1997. A new method of measuring dietabrasionandits effectonthe development of the for estomach. J.DairySci 80:2534– 2541.

    [59]     Griebel, P. J., M. Schoonderwoerd, and L. A. Babiuk. 1987. Ontogeny of the immune response: effect of protein energy mal nutrition in neonatal calves. Can. J. Vet. Res 51:428–435.

    [60]     Grzanna, R., L. Lindmark, and C. Frondoza. 2005. Ginger--an herbal medicinal product with broad anti-inflammatory actions. J Med Food 8:125-132.

    [61]     Guilloteau, P., I. L. Huërou-Luron, J. A. Chayvialle, R. Toullec, R. Zabielski, and J. W. Blum. 1997. Gut regulatory peptides in young cattle and sheep. Zentralbl. Veterinarmed 44:1-23.

    [62]     Hammon, H. M. and J.W.Blum. 1998. Metabolic ande ndocrine traits of neonatal calves arein fluenced by feeding colostrum for different durations or only milk replacer. J.Nutr 128:624– 632.

    [63]     Hammon, H. M., G. Schiessler, A. Nussbaum, and J. W. Blum. 2002. Feed intake patterns, growth performance, and metabolic and endocrine

    traits in calves fed unlimited amounts of colostrum and milk by automate, starting in the neonatal period. J. Dairy Sci. 85:3352–3362.

    [64]     Hart, K. J., D. R. Ruzi, S. M. Duval, N. R. McEwan, and C. J. Newbold. 2007. Plant extract to manipulate rumen fermentation. Anim. Feed. Sci. Tech. 54:588-596.

    [65]     Heinrichs, A. J. 1993. Raising dairy replacement stomeetthe needs of the 21st century. J.DairySci 76:3179– 3187.

    [66]     Heinrichs, A. J. and G.J.Bush. 1991. Evaluation of decoquinateor lasalocid against coccidiosis from natural exposure in neonatal dairy calves. J.DairySci 74:3223– 3227.

    [67]     Heinrichs, A. J., S.J.Wells, and W.C.Losinger. 1995. Astudyofthe use of milk replacers for dairy calves in the United States. J.Dairy Sci 78:2831– 2837.

    [68]     Hill, S. R., K. F. Knowlton, K. M. Daniels, R. E. James, R. E. Pearson, and A. V. Capuco. 2008. Effects of milk replacer composition on growth, body composition, and nutrient excretion in preweaned Holstein heifers. J. Dairy Sci 91:3145–3155.

    [69]     Hill, T. M., J. M. Aldrich, R. L. Schlotterbeck, and H. G. Bateman. 2006. Effects of feeding calves different rates and protein concentrations of twenty percent fat milk replacers on growth during the neonatal period. Prof. Anim. Sci

     22:252–260

     

    [70]     Hill, T. M., H. G. Bateman, J. M. Aldrich, and R. L. Schlotterbeck. 2009. Effects of fat concentration of a high-protein milk replacer on calf performance. J. Dairy Sci 92:5147–5153.

    [71]     Hodgson, J. 1971. The development of solid food intake in calves.5.The relationship between liquid and solid food intake. Anim.Prod 13:593– 597.

    [72]     Hopkins, B. A. and I. J.D.Quigley. 1997. Effects of method of colostrum feeding and colostrum supplementation onc oncentrations of immunoglobulin Ginthe serum of neonatal calves. J.DairySci 80:979– 983.

    [73]     Horosova, K., D. Bujnakova, V. Kme, and 2006. Effect of oregano essential oil on chicken Lactobacilli and E.coli. Folla Microbiol 51:278-280.

    [74]     http://animalherb.blogfa.com/page/1.aspx.

    [75]     Huber, J. T., A. G. Silva, and O. F. Campos. 1984. Influence of feeding different amounts of milk on performance, health, and absorption capability of baby calves. J. Dairy Sci 67: 2957–2963.

    [76]     Jasper, J. and D. M. Weary. 2002. Effects of ad libitum milk intake on dairy calves. J. Dairy Sci. 85:3054–3058.

    [77]     Jasper, J. and D. M. Weary. 2002. Effects of ad libitum milk intake on dairy calves. J. Dairy Sci 85:3054–3058.

    [78]     Jaster, E. H., G. C. McCoy, N. Spanski, and T. Tomkin. 1992. Effect of extra energy as fat or milk replacer solids in diets of young dairy calves on growth during cold weather. J. Dairy Sci. 75:2524-2531.

    [79]     Jenkins, K. J., J.K.G.Kramer, F.D.Sauer, and D.B.Emmons. 1985. Influence oftriglyceridesandfreefattyacidsinmilkreplacersoncalf performance, bloodplasma,andadiposelipids. J.DairySci 68:669– 680.

    [80]     Jenny, B. F., S. E. Mills, W. E. Johnston, and G. D. Dell. 1978. Effect of fluid intake and dry matter concentration on scours and water intake in calves fed once dialy. J. Dairy Sci. 61:765-770.

    [81]     K, P. A. 2011. Effects of essential oils on rumen fermentation, microbial

    ecology and ruminant production. Asian Journal of Animal and Veterinary

    Advances 6:416-428.

    [82]     Kaneko, J. J., J. W. Harvey, and M. L. Bruss. 2008. Clinical Biochemistry of Domestic Animals. 6th Edition, Academic Press, London: 117–138.

    [83]     Kertz, A. F., L.F.Reutzel, and J.H.Mahoney. 1984. Adlibitum water intake by neonatal calves and itsrelation ship to calf starter intake, weight gain,fecal score,and season. J.DairySci 76:2964– 2969.

    [84]     Kertz, A. F., L.R.Prewitt, and J. J.P.Everett. 1979. An early weaning calf program:summarization and review. J.DairySci 62:1835– 1843.

    [85]     Kertz, A. F., L. R. Prewitt, and J. P. E. Jr. 1979. An early weaning calf program: Summarization and review. J. Dairy Sci 62:1835–1843.

    [86]     Khaki, A. 2010. Antioxidant effect of ginger to prevents lead-induced liver tissue apoptosis in rat. Journal of Medicinal Plants Research 4(14):1492-1495.

    [87]     Khan, M. A., H. J. Lee, W. S. Lee, H. S. Kim, K. S. Ki, T. Y. Hur, G. H. Suh, S. J. Kang, and Y. J. Choi. 2007. Structural growth, rumen development, and metabolic and immune responses of Holstein male calves fed milk through step-down and conventional methods. J. Dairy Sci 90:3376–3387.

    [88]     Khan, M. A., H. J. Lee, W. S. Lee, H. S. Kim, S. B. Kim, K. S. Ki, J. K. Ha, H. G. Lee, and Y. J. Choi. 2007. Pre- and postweaning performance of Holstein female calves fed milk through step-down and conventional methods. J. Dairy Sci. 90:876–885.

    [89]     Khan, M. A., D. M. Weary, and M. A. G. v. Keyserlingk. 2011. Effects of milk ration on solid feed intake, weaning, and performance in dairy heifers. J. Dairy Sci. 94:1071–1081.

    [90]     Kholif, S., T. Morsy, M. Abdo, O. Matloup, and A. A. A. El-Ella. 2012. Effect of Supplementing Lactating Goats Rations with Garlic, Cinnamon or Ginger Oils on Milk Yield, Milk Composition and Milk Fatty Acids Profile. J Life Sci 4(1):27-34.

    [91]     Kristensen, J. S. N. B., S. K. Jensen, and M. Vestergaard. 2007. Effect of milk allowance on concentrate intake, ruminal environment, and ruminal development in milk-fed Holstein calves. J.Dairy Sci 90:4346–4355.

    [92]     Lammers, B. P., A.J.Heinrichs, and A.Aydin. 1998. The effect of whey protein concentrate or dried skim milk in milk replacer on calf performance and blood metabolites. J.DairySci 81:1940– 1945.

    [93]     Lesmeister, K. E. and A. J. Heinrichs. 2004. Effects of corn processing on growth characteristics, rumen development, and rumen parameters in neonatal dairy calves. J. Dairy Sci. 87:3439–3450.

    [94]     Lofgreen, C. P. and M. Kleiber. 1953. The method fecal nitrogen excretion of the yaoung calf and true digesibility of casein. j. Nutr 49:183-190.

    [95]     McCoy, G. C., J.K.Reneau, A.G.Hunter, and J.B.Williams. 1970. Effects of dietandtimeon blood serum proteins in the new borncalf. J. DairySci 53:358– 362.

    [96]     McGavin, M. D. and J.L.Morrill. 1976. Scanning electron microscopy of ruminal papillae in calves fed various amounts and forms of roughage. J.VetRes 37:497– 508.

    [97]     Miller-Cushon, E. K., R. Bergeron, K. E. Leslie, and T. J. DeVries. 2013. Effect of milk feeding level on development of feeding behavior in dairy calves. J. Dairy Sci 96:551–564.

    [98]     Moallem, U., D. Werner, H. Lehrer, M. Zachut, L. Livshitz, S. Yakoby, and A. Shamay. 2010. Long-term effects of ad libitum whole milk prior to weaning and prepubertal protein supplementation on skeletal

    growth rate and first-lactation milk production. J. Dairy Sci. 93:2639–2650.

    [99]     Morin, D. E., G.C.McCoy, and W.L.Hurley. 1997. Effects of quality, quantity, and timing of colostrum feeding and addition of a colostrum supplement on immunoglobulinG1 absorptionin Holstein bull calves. J. DairySci 80:747– 753.

    [100]   Morrill, J. L., A.D.Dayton, and R.Mickelsen. 1977. Cultured milk and antibiotics for young calves. J.DairySci 60:1105– 1109.

    [101]   Morrill, J. L., J.M.Morrill, A.M.Feyerherm, and J.F.Laster. 1995. Plasma proteins and aprobiotic a singredients in milkreplacer. J.Dairy Sci 78:902– 907.

    [102]   Mylrea, P. J. 1966. Digestion in young calves fed whole milk ad lib. and its relation ship to calf scours. Res. Vet. Sci. 7:407–416.

    [103]   NAHMS. 2007. Dairy 2007, part I: Reference of Dairy Cattle Health and Management Practices in the United States. Accessed July 8, 2009. http://nahms.aphis.usda.gov/dairy/dairy07/dairy2007_ highlightsPt1.pdf

     

    [104]   Nonnecke, B. J., M. R. Foote, J. M. Smith, B. A. Pesch, and M. E. V. Amburgh. 2003. Composition and functional capacity of blood mononuclear leukocyte populations from neonatal calves on standard and intensified milk replacer diets. J. Dairy Sci 86:3592–3604.

    [105]   Obeidat, B. S., C. J. Cobb, M. D. Sellers, A. R. Pepper-Yowell, T. J. Earleywine, and M. A. Ballou. 2013. Plane of nutrition during the preweaning period but not the grower phase influences the neutrophil activity of Holstein calves. J. Dairy Sci 96:1–12.

    [106]   Orskov, E. R. 1972. Reflex closure of the oesophagealgrooveandits potential application in ruminant nutrition.S.Af. J.Anim.Sci 2:169– 176.

    [107]   Ozkan, G., B. Simsek, and H. Kuleasan. 2007. Antioxidant activities of Satureja cilicica essential oil in butter and in vitro. Journal of Food Engineering 79:1391-1396.

    [108]   PettyJohn, D., J. P. Everett, and R. D. Mochrie. 1963. Responses of Dairy Calves to Milk Replacer Fed at Various Concentrations. J. Dairy Sci. 46:710-714.

    [109]   Phillips, R. W. 1985. Fluid ther apy for diarrheic calves.What,how and how much?Vet.Clin.North Am. Food Anim.Pract 1:541-562.

    [110]   Pollock, J. M., T.G.Rowan, J.B.Dixon, S.D.Carter, D.Spiller, and H. Warenius. 1993. Alteration of cellular immune responses by nutrition and weaning in calves. Res.Vet.Sci 55:298– 306.

    [111]   Preston, T. R. 1963. The nutrition of early weaned calf. World Rev. Nutr. Diet 4:117-139.

    [112]   Pritchett, L. C., C.C.Gay, T.E.Besser, and D.D.Hancock. 1991. Management and production factors in fluenc ing immunoglobulinG1 concentration in colostrum from Holstein cows. J.DairySci 74:2336– 2341.

    [113]   Qiao, G., C. Shao, T. Shao, X. Yang, X. Zhu, J. Li, and Y. Lu. 2013. Effects of supplemental Chinese herbs on growth performance, blood antioxidant function and

    immunity status in Holstein dairy heifers fed high fibre diet. Italian Journal of Animal Science 12:e20.

    [114]   Quigley, I., J.D. 1996. Feeding prior to weaning.In Calves, Heifers and Dairy Profit ability.Facilties, Nutrition,and Health. Northeast Regional Agricultural Engineering Service, Ithaca,NY:245– 255.

    [115]   Quigley, I., J.D and J.J.Drewry. 1998. Nutrient and immunity transfer from cow to calf pre-and post calving. J.DairySci 81:2779– 2790.

    [116]   Quigley, I., J.D, J.J.Drewry, L.M.Murray, and S.J.Ivey. 1997a. Body weight gain,feed efficiency and fecal scores of dairy calvesin response togalactosyl-lactoseor antibiotics in milk replacers. J.Dairy Sci 80:1751– 1754.

     

    [117]   Quigley, I., J.D, J.J.Drewry, L.M.Murray, and S.J.Ivey. 1997b. Effects of lasalocid in milk replacer or calf starter on health and performance of calves challenged with Eimeriaspecies. J.DairySci 80:2972– 2976.

    [118]   Quigley, I., J.D, L.B.Wallis, H.H.Dowlen, and R.N.Heitmann. 1992. Sodium bicarbonate and yeas tculture effects on ruminal fermentation,growth, and in takein dairy calves. J.DairySci 75:3531– 3538.

    [119]   Radostits, O. M., C. C. Gay, D. C. Blood, and K. W. Hinchcliff. 2007. Veterinary Medicine. 10th Edition, Baillier Tindall, London, Philadelphia, New York:303–311.

    [120]   Raeth-Knight, H. C.-J. M., S. Hayes, J. Linn, R. Larson, D. Ziegler, B. Ziegler, and N. Broadwater. 2009. Impact of conventional or intensive milk replacer programs on Holstein heifer

    performance through six months of age and during first lactation. J. Dairy Sci. 92:799–809.

    [121]   Raven, A. M. 1970. Fatin milk replacers for calves. J.Sci.Food Agric 21:352– 359.

    [122]   Reddy, P. G., J.L.Morrill, H.C.Minocha, M.B.Morrill, A.D.Dayton, and R.A.Frey. 1986. Effect of supplemental vitamin E on theimmune system of calves. J.DairySci 69:164– 171.

    [123]   Research Council, N. 1968. Prenatal and Post natal Mortalityin Cattle, Publication1685. Washington,DC:Natl.Acad.Sci.

    [124]   Research Council, N. 1989. Nutrient Requirements of DairyCattle, 6th rev.ed.Washington,DC. National Academy Press.

    [125]   Richard, A. L., L. D. Muller, and A. J. Heinrichs. 1988. Ad libitum or twice daily feeding of acidified milk replacer to calves housed individually in warmand cold environments. J. Dairy Sci 71: 2193–2202.

    [126]   Ridder, T. A., J.W.Young, K.A.Anderson, D.W.Lodman, K.G.Odde, and D.E.Johnson. 1991. Effects of prepartum energy nutrition and body condition on birth weight and basal metabolism in bovineneonates. J.Anim.Sci 69(Suppl.1):450.

    [127]   Roth, B. A., N. M. Keil, L. Gygax, and E. Hillmann. 2009. Influence of weaning method on health status and rumen development in dairy calves. J. Dairy Sci 92:645-656.

    [128]   Rowan, T. G. 1992. Thermo regulation in neonatal ruminants. Anim.Prod 15:13– 24.

    [129]   Roy, J. H. 1970. Protein in milk replacers for calves. J. Sci. Food Agric 21(7):364-351.

    [130]   Rushen, J. and A. M. d. Passillé. 1995. The motivation of non-nutritive sucking in calves, Bos taurus. Anim. Behav 49:1503–1510.

    [131]   Sander, E. G., R.G.Warner, H.N.Harrison, and J.K.Loosli. 1959. The stimulatory effect of sodium  butyrate and sodium propionateon the development of rumen mucosa in the young calf. J.DairySci 42:1600– 1605.

    [132]   Sander, E. G., H. N. Warner, H. N. Harrison, and J. K. Loosli. 1959. The stimulatory effect of sodium butyrate and sodium propionate.

    [133]   Savage, E. S. and C. M. McCay. 1942. The nutrition of calves. J. Dairy Sci. 25:595–650.

    [134]   SchiDgoetbe, D. J., D. P. Casper, J. K. Drackley, and F. C. Ludens. 1986. Increased solids intake and feediDg fnlqumcy for calves in hutches duriDg cold weather. J.Dairy Sci 69:1063.

    [135]   Schrama, J. W., A. Arieli, and W. V. D. Hel. 1993. Evidence of increasing thermal requirement in young, unadapted calves during 6 to 11 days of age. J. Anim Sci 71:1761–1766.

    [136]   Senn, M., S. Gross-Luem, H. Leuenberger, and W. Langhans. 2000. Meal patterns and meal-induced metabolic changes in calves fed milk ad lib. . Physiol. Behav. 70:189–195.

    [137]   Shasany, A. K., D. saikia, and s. p. s. khanuja. Medicinal plant trade, value addition and biotechnology. Proceeding of First National Interactive Meet on Meet on Medicinal and Aromatic plants (eds. A. K. mathar et al.) Cimap, Lucknow, UP, Indian, pp. 68-70.

    [138]   Shen, Z., H. M. Seyfert, B. Lohrke, F. Schneider, R. Zitnan, A. Chudy, S. Kuhla, H. M. Hammon, J. W. Blum, H. Martens, H. Hagemeister, and J. Viogt. 2004. An energy rich diet causes rumen papillae proliferation associated with more IGF type 1 receptors and increased plasma IGF-1 concentrations in young goats. J. Nutr 134:11-17.

    [139]   Smith, B. P. 2009. Large Animal Internal Medicine. 4th Edition, Mosby Pub, USA.

    [140]   Smith, J. M., M. E. V. Amburgh, M. C. Diaz, M. C. Lucy, and D. E. Bauman. 2002. Effect of nutrient intake on the development of the somatotropic axis and its responsiveness to GH in Holstein bull calves. J. Anim. Sci. 80:1528–1537.

    [141]   Soberon, F., E. Raffrenato, R. W. Everett, and M. E. V. Amburgh. 2009. Early life management and long term productivity of dairy calves. J. Dairy Sci. 92:238.

    [142]   Soberon, F., E. Raffrenato, R. W. Everett, and M. E. V. Amburgh. 2012. Preweaning milk replacer intake and effects on long-term productivity of dairy calves. J. Dairy Sci 95:783–793.

    [143]   Soberon, F., R. W. Raffrenato, Everett, and M. E. V. Amburgh. 2009. Early life management and long term productivity of dairy calves. J. Dairy Sci 92:238

     

    [144]   Soltan, M. A. 2009. Effect of Essential Oils Supplementation on Growth Performance, Nutrient Digestibility, Health Condition of Holstein Male Calves During Pre- and Post-Weaning Periods. Pakistan Journal of Nutrition 8 (5):642-652.

    [145]   Stamey, J. A., N. A. Janovick, A. F. Kertz, and J. K. Drackley. 2012. Influence of starter protein content on growth of dairy calves in an enhanced early nutrition program. J. Dairy Sci 95:3327–3336.

    [146]   Stobo, I. J. and J. H. Roy. 1973. The protein requirement of rumininant calf. 4. Nitrogen balance studies on repidly geowing given diets of diffrent protein content. Br. J. Nutr:113-125.

    [147]   Stobo, I. J. F., J. H. B. Roy, and H. J. Gaston. 1966. Rumen development in the calf. 1. The effect of diets containing different proportions of concentrates to hay on rumen development. Br. J. Nutr 20:171–188.

    [148]   suarez cretton, b. j. 2006. Rumen development in veal (preruminant) calves. Wageningen university dissertation no.4071, Wageningen, The netherlands:19-46.

    [149]   Sudipta, G., R. K. Mehla, S. K. Sirohi, and B. Roy. 2010. The effect of dietary garlic supplementation on body weight gain, feed intake, feed conversion efficiency, faecal score, faecal coliform count and feeding cost in crossbred dairy calves. Trop. Anim. Health Prod. 42:961–968.

    [150]   Svensson, C., K. Lundborg, U. Emanuelson, and S. Olsson. 2003. Morbidity in Swedish dairy calves from birth to 90 days of age and individual calf-level risk factors for infectious diseases. Prev. Vet. Med. 58:179–197.

    [151]   Sweeney, B. C., J. P. Rushen, D. M. Weary, and A. M. B. d. Passillé. 2010. Duration of weaning, starter intake, and weight gain of dairy calves fed large amounts of milk. J. Dairy Sci. 93:148–152.

    [152]   Tamate, H., A. D. McGilliard, N. L. Jacobson, and R. Getty. 1962. Effect of various dietaries on the anatomical development of the stomach in the calf. J. Dairy Sci 45:408–420.

    [153]   Terosky, T. L., A.J.Heinrichs, and L.L.Wilson. 1997. Acomparison of milkproteinsourcesindietsofcalvesuptoeightweeksofage. J. DairySci 2977– 2983:80.

    [154]   Terré, M., M. Devant, and A. Bach. 2007. Effect of level of milk replacer fed to Holstein calves on performance during the preweaning period and starter digestibility at weaning. Livest. Sci. 110:82–88.

    [155]   Thomas, T. J., D. M. Weary, and M. C. Appleby. 2001. Newborn and 5-week-old calves vocalise in response to milk deprivation. Appl. Anim. Behav. Sci. 74:165–173.

    [156]   Tikofsky, J. N., M. E. V. Amburgh, and D. A. Ross. 2001. Effect of varying carbohydrate and fat content of milk replacer on body composition of Holstein bull calves. J. Anim Sci 79:2260–2267.

    [157]   Toullec, R. and P.Guilloteau. 1989. Researchin to the digestive physiology of the milk-fed calf. In:Nutrition and Digestive Physiologyin Monogastric Farm Animals,edited by E.J.Van WeerdonandJ.Huisman:37– 55.

    [158]   V, C. A., K. Stanford, L. L. Gibson, T. A. McAllister, and C. Benchaar. 2008. Effects of carvacrol and cinnamaldehyde on intake, rumen fermentation, growth performance, and carcass characteristics of growing lambs. Animal Feed Science and Technology 145:396–408.

    [159]   Van Amburgh, M. and J. Drackley. 2005. Current perspectives on the energy and protein requirements of the pre-weaned calf. In: Garnsworthy PC, editor. Calf and heifer rearing. Nottingham (UK): Nottingham University Press.

    [160]   Van Saun, R. J., T.H.Herdt, and H.D.Stowe. 1989a. Maternaland fetal seleniumconcentrationsandtheirinterrelationshipsindairycattle. j. Nutr 119:1128– 1113.

    [161]   von Keyserlingk, M. A. G., J. Rushen, A. M. B. d. Passillé, and D. M. Weary. 2009. Invited review: The welfare of dairy cattle-Key concepts and the role of science. J. Dairy Sci. 92:4101-4111.

    [162]   Walker, P. G., P.D.Constable, D.E.Morin, J.K.Drackley, J.H.Foreman, and J.C.Thurmon. 1998. Areliable,practical,andeconomical protocolforinducing diarrhea and severe dehydration in the neonatal calf. Can.J.Vet.Res 62:205– 213.

    [163]   Warner, R. G. 1991. Nutritional factors affecting the development of afunctional ruminant—A historical perspective. Proc.CornellNutr. Conf: 1– 12.

    [164]   Warner, R. G., W. P. Flatt, and J. K. Loosli. 1956. Dietary factors influencing the development of the animal’s stomach. Journal of Agricultural and Food Chemistry 4:788–792.

    [165]   Webster, A. J. F., H.Donnelly, J.M.Brockway, and J.S.Smith. 1975. Energy exchanges of veal calves fed high-fat milk replacer diet containing different amountsofiron. Anim.Prod 20:69– 75.

    [166]   Williams, A. P. 1994. Amino acid requirements of the veal calf and beef steer. In: D’Mello JPF, editor. Amino acids in farm animal nutrition. CAB International.

    [167]   Williams, P. E. V. and A.J.Frost. 1992. Feeding the young ruminant.In Neonatal Survivaland Growth, edited by M.Varley,P.E.V.Williams, and T.L.J.Lawrence, Occasional Publ. Anim.Prod 15:109– 118.

    [168]   Williams, P. E. V. and A. J. Frost. 1992. Feeding the young ruminant. Pages 109–118  in Neonatal Survival and Growth. Occasional Publ. No. 15. M. Varley, P. E. V. Williams, and T. L. J. Lawrence, ed. Br. Soc. Anim. Prod., Edinburgh, UK.

    [169]   Williams, P. E. V. and A. J. Frost. 1992. Feeding the young ruminant. Br. Soc. Anim. Prod., Edinburgh, UK 109-118.

    [170]   Wilson, G. A. and J.V.Wheelock. 1972. .Factors affectingtheaction of rennin in heated milk. J.DairyRes 39:413– 419.

    [171]   Yesilbag, D., M. Eren, H. Agel, A. Kovanlikaya, and F. Balci. 2011. Effects of dietary rosemary, rosemary volatile oil and vitamin E on broiler performance, meat quality and serum SOD activity. British Poultry Science 52(4):472-482.

    [172]   Zhang, G. F., Z. B. Yang, Y. Wang, W. R. Yang, S. Z. Jiang, and G. S. Gai. 2009. Effects of ginger root (Zingiber officinale) processed to different particle sizes on growth performance, antioxidant status, and serum metabolites of broiler chickens. Poultry Science 88 2159-2166.

     


تحقیق در مورد پایان نامه اثر درصد ماده خشک شیر و ترکیبی از گیاهان دارویی بر عملکرد و فراسنجه های خونی گوساله های شیر خوار, مقاله در مورد پایان نامه اثر درصد ماده خشک شیر و ترکیبی از گیاهان دارویی بر عملکرد و فراسنجه های خونی گوساله های شیر خوار, پروژه دانشجویی در مورد پایان نامه اثر درصد ماده خشک شیر و ترکیبی از گیاهان دارویی بر عملکرد و فراسنجه های خونی گوساله های شیر خوار, پروپوزال در مورد پایان نامه اثر درصد ماده خشک شیر و ترکیبی از گیاهان دارویی بر عملکرد و فراسنجه های خونی گوساله های شیر خوار, تز دکترا در مورد پایان نامه اثر درصد ماده خشک شیر و ترکیبی از گیاهان دارویی بر عملکرد و فراسنجه های خونی گوساله های شیر خوار, تحقیقات دانشجویی درباره پایان نامه اثر درصد ماده خشک شیر و ترکیبی از گیاهان دارویی بر عملکرد و فراسنجه های خونی گوساله های شیر خوار, مقالات دانشجویی درباره پایان نامه اثر درصد ماده خشک شیر و ترکیبی از گیاهان دارویی بر عملکرد و فراسنجه های خونی گوساله های شیر خوار, پروژه درباره پایان نامه اثر درصد ماده خشک شیر و ترکیبی از گیاهان دارویی بر عملکرد و فراسنجه های خونی گوساله های شیر خوار, گزارش سمینار در مورد پایان نامه اثر درصد ماده خشک شیر و ترکیبی از گیاهان دارویی بر عملکرد و فراسنجه های خونی گوساله های شیر خوار, پروژه دانشجویی در مورد پایان نامه اثر درصد ماده خشک شیر و ترکیبی از گیاهان دارویی بر عملکرد و فراسنجه های خونی گوساله های شیر خوار, تحقیق دانش آموزی در مورد پایان نامه اثر درصد ماده خشک شیر و ترکیبی از گیاهان دارویی بر عملکرد و فراسنجه های خونی گوساله های شیر خوار, مقاله دانش آموزی در مورد پایان نامه اثر درصد ماده خشک شیر و ترکیبی از گیاهان دارویی بر عملکرد و فراسنجه های خونی گوساله های شیر خوار, رساله دکترا در مورد پایان نامه اثر درصد ماده خشک شیر و ترکیبی از گیاهان دارویی بر عملکرد و فراسنجه های خونی گوساله های شیر خوار

پايان نامه مقطع دکترا رشته دامپزشکي الف - باروري و ناباروري   اصطلاح باروري[1] درگاو ماده نشان دهنده ميل‌ و قدرت جفتگيري، توانايي بارورشدن، تغذيه رويان و بالاخره قدرت خارج کردن گوس

پایان نامه دکتری حرفه­ای رشته­ی دامپزشکی چکیده: یکی از بهترین ابزارهای مدیریتی، دادن اسکور بدنی است که برای تولید­کنندگان به عنوان عاملی برای تولید، ارزیابی سلامت و وضعیت غذایی قلمداد می شود. این روش کمک می­کند تا یک گروه یا گله گاو از نظر ذخایر بدن به ویژه چربی و ماهیچه ارزیابی شود. اسکور بدنی در تمام مراحل چرخه تولید، تغذیه و مدیریت ممکن است تغییر کند. اسکور بدنی هر گاو، نشان ...

پایان نامه جهت دریافت درجه کارشناسی ارشد (M.Sc) رشته: تولیدات گیاهی (گرایش تولید محصولات باغبانی) عنوان پایان نامه: تأثیر انواع بستر و تاریخ کاشت بر رشد، عملکرد و اجزای عملکرد بذر گیاه ریحان (Ocimum basilicum.L) به منظور مطالعه تأثیر انواع بستر و تاریخ کاشت بر میزان تولید عملکرد بذر ریحان در طی سال های 92- 91 آزمایشی به صورت فاکتوریل در قالب بلوک های کامل تصادفی با دو فاکتور ...

پایان نامه برای دریافت درجه کارشناسی ارشد تغذیه دام و طیور چکیده این تحقیق به منظور بررسی اثر سطوح مختلف اسانس مرزه شامل سطوح (صفر میلی گرم ، 200 میلی گرم، 400 میلی گرم) و نوع دانه غلات(ذرت و جو) بر روند تخمیر شکمبه ای ، عملکرد حیوان و برخی فراسنجه های خونی بزغاله های بومی آذربایجان غربی انجام شد. در این آزمایش از 36 بزغاله ماده بومی آذربایجان غربی استفاده شد. جیره آزمایشی به ...

چکیده گوشت شتر مرغ که در گروه گوشت های قرمز طبقه بندی می شود، از ارزش غذایی بسیار بالایی برخورداراست، طوری که می توان گفت یکی از کم چرب ترین و سالم ترین نمونه های گوشت قرمز در دسترس است. Heracleum Persicum یا گیاه گلپر ایرانی(از خانواده Apiaceae) یکی از 10 گونه جنس هراکلوم در ایران است. پژوهش حاضر، با توجه به خواص ضدمیکروبی گیاه گلپر و همچنین فراوانی آن در کشور، به بررسی امکان ...

چکیده این تحقیق به منظور بررسی مشخصات جذب فلزات کبالت، کادمیم و نیکل با استفاده از پوست لیمو انجام پذیرفته است. اثر پارامتر­های مختلف نظیرpH محلول، میزان جاذب، زمان تماس و دما بر فرآیند جذب مورد بررسی قرار گرفت و شرایط عملیاتی بهینه جذب هر عنصر بر روی جاذب زیستی مشخص گردید. مقادیر تعادلی جذب با مدل­های ایزوترم لانگمویر، فرندلیچ، تمکین وD-R مورد بررسی قرار گرفتند و پارامترهای هر ...

پایان نامه جهت اخذ درجه کارشناسی ارشد رشته: مهندسی کشاورزی گرایش: مدیریت کشاورزی چکیده به منظور بررسی مدیریت آبیاری توتون که یکی از محصولات با ارزش کشاورزی و صنعتی است و در شرایط مختلف آب و هوایی کشت می­شود، آزمایشی به صورت کرت­های خرد شده بر پایه بلوک­های کامل تصادفی با در نظر گرفتن 50 (I1) ، 75 (I2) و 100(I3) درصد نیاز آبی گیاه در کرت­های اصلی و ارقام توتون Coker347 (V1) ، ...

پایان‌نامه برای دریافت درجه کارشناسی‌ارشد در رشته مهندسی باغبانی چکیده : دستیابی به کشاورزی پایدار در کنار افزایش عملکرد محصولات کشاورزی و تامین سلامت جامعه از اهداف محققین در بخش کشاورزی است. در چند دهه اخیر مصرف نهاده های شیمیایی در اراضی کشاورزی موجب معضلات زیست محیطی عدیده ای از جمله آلودگی منابع آب و خاک ، کاهش حاصلخیزی و از بین رفتن تعادل عناصر شیمیایی در خاک است. از جمله ...

پایان نامه جهت دریافت مدرک کارشناسی ارشد (MSc) در رشته علوم دامی- گرایش تغذیه دام چکیده به‌منظور بررسی اثر پودر رزماری و ویتامین E بر عملکرد، فراسنجه‌ های خونی، سیستم ایمنی، وکمیّت و کیفیت لاشه جوجه‌ های گوشتی، آزمایشی در قالب طرح فاکتوریل انجام شد. برای این منظور 270 جوجه یک روزه نر، سویه راس 308 در نه تیمار قرار گرفتند: تیمار اول: بدون پودر رزماری و ویتامین E، تیمار دوم: بدون ...

پایان­نامه جهت اخذ مدرک کارشناسی ارشد (M.Sc) چکیده: به منظور بررسی تاثیر مقادیر مختلف آهن و گوگرد بر عملکرد و اجزای عملکرد گیاه بادام زمینی، آزمایش فاکتوریل در قالب طرح بلوک کامل تصادفی در 3 تکرار با 4 سطح کود گوگرد ازمنبع کود گوگرد گرانوله) شامل 0 ،40 ، 80 و 120 کیلوگرم در هکتار) و کود آهن از منبع کلات آهن ) به صورت محلول پاشی شامل 0، 2، 4 و 6 در هزار) در شهرستان آستانه اشرفیه ...

ثبت سفارش